IGF-1 LR3 1mg

$89.99

(5.0) (57 customer reviews)

Researched Benefits:

  • Promotes muscle growth and development
  • Enhances fat metabolism and reduces body fat
  • Improves recovery and repair
  • Boosts cognitive function and memory

Quantity:

Free Shipping
Buy Peptides with confidence: Stripe-powered secure checkout and major cards accepted.
Secure payment methods for buying peptides: Visa, MasterCard, AMEX, and more.
Buy Peptides with confidence: Stripe-powered secure checkout and major cards accepted.
Secure payment methods for buying peptides: Visa, MasterCard, AMEX, and more.

FREE Shipping on 

orders over $200

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are intended solely for research and laboratory use. These products are not intended for human or animal consumption. They are not medicines or drugs and have not been evaluated or approved by the FDA to diagnose, treat, cure, or prevent any disease or medical condition. Any form of bodily introduction is strictly prohibited by law.

Description

IGF-1 LR3 1mg is an engineered variant of the insulin-like growth factor 1 (IGF-1) designed to increase potency and stability, making it ideal for research into growth factor-related processes. Produced using state-of-the-art synthesis methods, our IGF-1 LR3 offers exceptional purity and biological activity for demanding research needs.

Key Features:

  • Engineered for enhanced biological activity and prolonged half-life compared to native IGF-1.
  • Subject to strict quality control protocols to ensure product reliability and consistency.
  • Offered in lyophilized form to ensure stability during storage and handling.

Applications:

  • Exploring effects on cell growth, differentiation, and survival.
  • Studying metabolic effects related to muscle development and aging.
  • Researching potential therapeutic applications in muscle wasting diseases and metabolic disorders.

Specifications and Documentation

 

  • Material Safety Data Sheet (MSDS): Coming Soon.
  • Handling and Storage Instructions: Coming Soon.

 

IGF-1 LR3 1mg is widely appreciated in the research community for its role in advanced studies of growth factors, offering insights into cellular mechanisms and potential therapeutic targets.

Additional information

CAS No.

946870-92-4

Purity

≥99%

Sequence

MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

C331H519N109O101

Molecular Weight

9117.60 g/mol

Synthesis

Solid-phase synthesis

Format

Lyophilized powder

Solubility

Soluble in water or 1% acetic acid

Stability & Storage

Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months.

Applications

Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders

Appearance

White lyophilized powder

Shipping Conditions

Shipped at ambient temperature; once received, store at -20°C

Regulatory/Compliance

Manufactured in a facility that adheres to cGMP guidelines

Safety Information

Refer to provided MSDS

There are no reviews yet.

We value your feedback. Please leave a review below:

Have Questions?

Our team is ready to assist you with any inquiries regarding our catalogue of peptides and their applications.

Pure Lab Peptides Logo with Black Letters
1