$89.99
Research Studies:
FREE Shipping on
orders over $200
ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are intended solely for research and laboratory use. These products are not intended for human or animal consumption. They are not medicines or drugs and have not been evaluated or approved by the FDA to diagnose, treat, cure, or prevent any disease or medical condition. Any form of bodily introduction is strictly prohibited by law.
IGF-1 LR3 1mg is a research-use-only laboratory material supplied for controlled research workflows, compound characterization, and analytical documentation review. It is manufactured under rigorous quality standards to support consistency, traceability, and batch-specific verification for qualified laboratory settings.
IGF-1 LR3 1mg is intended strictly for laboratory research use only. This product is not intended for human or animal consumption, therapeutic use, diagnostic use, clinical use, veterinary use, or as a food, drug, cosmetic, dietary supplement, or household product.
| CAS No. | 946870-92-4 |
|---|---|
| Purity | ≥99% |
| Sequence | MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular Formula | C331H519N109O101 |
| Molecular Weight | 9117.60 g/mol |
| Synthesis | Solid-phase synthesis |
| Format | Lyophilized powder |
| Solubility | Soluble in water or 1% acetic acid |
| Stability & Storage | Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months. |
| Applications | Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders |
| Appearance | White lyophilized powder |
| Shipping Conditions | Shipped at ambient temperature; once received, store at -20°C |
| Regulatory/Compliance | Manufactured in a facility that adheres to cGMP guidelines |
| Safety Information | Refer to provided MSDS |
Consider these supplementary peptides for a comprehensive research approach.
Researchers searching for buy IGF-1 LR3 online should evaluate IGF-1 LR3 as a research-use-only laboratory material, not a consumer product. For laboratory buyers, the key considerations are compound identity, purity documentation, batch-specific COAs, lot traceability, product labeling, and storage information. This guide explains how to evaluate IGF-1 LR3 for controlled research procurement through Pure Lab Peptides while keeping published IGF-system literature separate from product-use claims.
Researchers can buy IGF-1 LR3 online for laboratory research by reviewing RUO labeling, batch-specific COA documentation, purity data, identity information, storage guidance, and supplier transparency before selecting a source. Products discussed in this article are intended for laboratory research use only and are not intended for human or animal consumption. The core procurement question is documentation quality.
The phrase “buy IGF-1 LR3 online” is addressed here as laboratory research procurement intent, not personal-use intent. In this context, buying online means evaluating whether a supplier presents IGF-1 LR3 as a research-use-only compound with transparent product labeling, batch-specific documentation, purity information, identity testing, and storage guidance.
Qualified researchers, laboratory buyers, research institutions, and technical procurement teams should separate commercial availability from scientific suitability. A responsible RUO procurement process reviews supplier claims, verifies whether documentation is batch-specific, and confirms that the material is not positioned for human or animal consumption. FDA guidance on research-use-only and investigational-use-only labeling for in vitro diagnostic products emphasizes that labeling and promotional context should align with intended use, which is a useful procurement principle even outside that exact product category [1].
Supplier evaluation should also consider whether testing practices and documentation controls are consistent with recognized laboratory quality concepts. ISO/IEC 17025 describes competence and consistent operation requirements for testing and calibration laboratories, while NIST reference-material resources illustrate why certificates and lot-level documentation matter in scientific recordkeeping [2] [3].
IGF-1 LR3 is commonly identified in laboratory and analytical references as Long R3 insulin-like growth factor I or Long-Arg3 IGF-I. PubChem lists a substance record for Long-(arg3)insulin-like growth factor-I, supporting its identity as a defined research material rather than a broad product category [4].
IGF-1 LR3 is related to the insulin-like growth factor research area. NCBI Gene identifies human IGF1 as the gene encoding insulin-like growth factor 1, and UniProt maintains the reviewed protein entry for human IGF1 [5] [6]. Foundational sequence literature described human IGF-I as a single-chain polypeptide with structural homology to proinsulin [7].
Published analytical literature describes Long-Arg3-IGF-I as an 83-amino-acid analog of human IGF-I, with a molecular mass reported around 9110 in that study context [8]. The same literature discusses differences between Long-Arg3-IGF-I and native IGF-I in relation to IGF-binding proteins, which should be read as scientific context, not product-use guidance [8].
IGF-system reviews describe a research landscape involving IGF ligands, receptors, and binding proteins [9]. UniProt identifies IGF1R as the insulin-like growth factor 1 receptor protein entry, and structural reviews of IGF-binding proteins provide additional context for why identity and binding-protein terminology may appear in the literature [10] [11]. Published literature discussing IGF signaling or IGF-1 analogs should not be interpreted as use guidance for RUO materials.
Researchers may search “buy IGF-1 LR3 online” to compare RUO product availability, product form, documentation access, and supplier transparency. The intent should be procurement review, not personal-use decision-making. A laboratory buyer looking to buy IGF-1 LR3 should focus on whether the supplier provides enough documentation to support internal purchasing records and controlled laboratory workflows.
Relevant procurement details include the compound display name, amount, product form, RUO labeling, purity claim, batch-specific IGF-1 LR3 COA, lot number, identity information, and storage documentation. Researchers should also review whether the supplier avoids unsupported product claims and maintains a clear distinction between published literature and the specific RUO material being purchased.
For IGF-1 LR3 research material, the most useful supplier documentation is not promotional language. It is evidence that the material name, label, COA, purity documentation, identity testing, and lot traceability align. This is especially important for peptide and peptide-analog materials because analytical characterization often requires multiple forms of evidence, not a single purity number.
Researchers who buy IGF-1 LR3 online for laboratory research should evaluate documentation signals before comparing price or convenience. Analytical method validation guidance from ICH Q2(R2) explains key concepts for analytical procedures, while peptide-focused guidance from FDA and EMA highlights why identity, impurities, characterization, and specifications are important in peptide analysis contexts [12] [13] [14].
| Evaluation Area | What Researchers Should Review | Why It Matters for RUO Procurement |
| RUO labeling | Confirm the product is clearly labeled for research use only | Helps separate research procurement from human-use positioning |
| COA availability | Review batch-specific certificate of analysis documentation | Supports lot-level documentation and quality review |
| Purity data | Look for analytical support for the stated purity | Helps evaluate material consistency |
| Identity testing | Review HPLC, LC-MS, mass spectrometry, or related identity data | Helps confirm the material matches the listed compound |
| Lot traceability | Match lot numbers across product and documentation | Supports research recordkeeping |
| Product form | Confirm whether the material is supplied as lyophilized powder or another documented form | Supports laboratory planning |
| Storage information | Review storage and handling documentation | Helps maintain material integrity in laboratory settings |
| Supplier language | Confirm the supplier avoids dosing, therapeutic, or personal-use claims | Supports research-use-only positioning |
IGF-1 LR3 purity documentation should be reviewed as part of a broader identity and traceability package. Researchers should look for the compound name, product amount, lot number, test date, purity percentage, test method, identity confirmation, molecular-weight information where relevant, sequence information where relevant, chromatogram or mass data where available, and storage documentation.
A purity percentage alone does not establish complete compound identity; researchers should evaluate purity, identity, method, lot number, and documentation together. USP discussion of peptide reference standards highlights the role of methods such as chromatography and mass spectrometry in peptide identity, assay, and purity work [15]. NIST certificate resources also illustrate why lot or serial-number matching is important when documentation is tied to a specific material batch [16].
Product form should also be recorded. Lyophilized peptide or protein materials are commonly evaluated with attention to storage and solid-state stability because peptide materials can be sensitive to formulation, handling, and storage conditions. Literature on peptide and protein lyophilization notes that changes can occur during lyophilization or storage, supporting the need for documented handling controls rather than assumptions [17] [18].
Published IGF-1 LR3 literature includes compound description, assay development, cell-culture research context, and analytical detection methods. For example, one published report evaluated Long R3 IGF-I in serum-free HEK293 cell culture conditions, which is a controlled research context and not product-use guidance [19]. Broader mammalian recombinant-protein production literature describes how cell-culture systems are optimized in research and bioprocess settings, but those discussions should not be converted into claims about a specific RUO product [20].
Analytical literature has also examined synthetic IGF-1 analogs using LC-MS and related mass spectrometry workflows. Published studies include liquid chromatography quadrupole time-of-flight mass spectrometry for synthetic IGF-1 analogs, LC-MS methods for LongR3-IGF-I, and tandem mass spectrometry approaches for IGF-1 and related analogs [21] [22] [23]. Additional high-resolution mass spectrometry literature has specifically discussed LongR3-IGF-I detection workflows [24].
This evidence landscape is useful for compound characterization, identity terminology, analytical expectations, and literature review. It should not be interpreted as product-use guidance. Published clinical literature should not be interpreted as use guidance for RUO materials. Reviews of the IGF system and IGF-binding proteins show that the research area is biologically complex, which reinforces the need to keep supplier documentation separate from scientific hypotheses or model-specific findings [25].
| Research Area | What Literature Examines | Evidence Type | RUO Interpretation |
| Compound identity | Molecular identity, analog terminology, sequence-related information, and classification | Database / analytical | Supports identification, not product-use claims |
| Pathway or category context | IGF-system receptors, binding proteins, and model-specific research areas | Review / in vitro / analytical | Useful for research context, not therapeutic claims |
| Analytical testing | Purity, identity, and batch verification | HPLC / LC-MS / mass spectrometry / COA | Supports documentation review |
| Storage and stability | Material form and handling considerations | Laboratory documentation | Supports research workflow planning |
| Research-Safe Statement | Why It Is Acceptable | Non-Compliant Version to Avoid |
| “IGF-1 LR3 is discussed in published research related to IGF analog and IGF-system research.” | Describes literature context without making a product claim | “IGF-1 LR3 helps with a human outcome.” |
| “Researchers should review COA and identity data before procurement.” | Focuses on documentation and quality review | “Users should buy IGF-1 LR3 for results.” |
| “Pure Lab Peptides supplies IGF-1 LR3 as a research-use-only material.” | Clarifies intended use | “Pure Lab Peptides supplies IGF-1 LR3 for therapy.” |
| “The phrase buy IGF-1 LR3 online is addressed as research procurement intent.” | Qualifies commercial search intent | “Buy IGF-1 LR3 online for personal use.” |
| “IGF-1 LR3 purity documentation should be evaluated with identity testing and lot traceability.” | Connects quality review to analytical documentation | “A purity percentage alone proves everything a buyer needs to know.” |
Pure Lab Peptides presents IGF-1 LR3 1mg as a research-use-only laboratory material. The product is listed with a ≥99% purity claim, supplied as lyophilized powder, and supported by a batch-specific COA that is available for review. For research procurement, these details should be evaluated alongside product labeling, product-page information, storage and handling documentation, lot-level traceability, and supplier transparency.
Review the Pure Lab Peptides IGF-1 LR3 research-use-only product page for RUO labeling, product details, purity information, and batch-specific documentation. Researchers comparing materials can also review the broader Pure Lab Peptides research peptide collection, the research documentation blog, and shipping and returns information for procurement planning.
Buy IGF-1 LR3 online should not be interpreted as personal-use guidance on this page. The phrase is addressed as laboratory procurement intent for qualified researchers reviewing RUO labeling, documentation, purity data, identity information, and supplier transparency.
Published literature about IGF-system biology, IGF analogs, cell-culture models, or analytical workflows does not create instructions for any RUO material. Literature can help researchers understand terminology and context, but procurement decisions should still be based on product labeling, COA review, and batch-specific documentation.
A stated purity percentage is only one part of IGF-1 LR3 purity documentation. Researchers should also review identity testing, analytical method, lot number, product name consistency, molecular information where provided, and the relationship between the label and the batch-specific COA.
For laboratory procurement, a generic document is less useful than batch-specific documentation. Researchers should confirm that the IGF-1 LR3 COA matches the product lot and supports internal purchasing records, material tracking, and controlled research documentation.
Research-use-only labeling narrows the intended context. It does not support consumer positioning, clinical positioning, animal-use positioning, or outcome-based supplier claims. Researchers should prefer suppliers that keep RUO materials framed around documentation, identity, purity, lot traceability, and controlled laboratory procurement.
Supplier claims should not replace IGF-1 LR3 supplier documentation. Laboratory buyers should review the batch-specific COA, analytical testing information, purity claim, identity support, and product-page details before approving a research-use-only material for procurement.
Researchers can buy IGF-1 LR3 online for laboratory research from an RUO supplier that provides clear product labeling, batch-specific COA documentation, purity information, identity support, and storage guidance. Pure Lab Peptides lists IGF-1 LR3 1mg as a research-use-only material with batch-specific documentation available for review.
Before buying IGF-1 LR3 online, researchers should check RUO labeling, batch-specific COA access, lot number consistency, purity documentation, identity testing, product form, storage information, and supplier language. The supplier should frame IGF-1 LR3 as a laboratory research material rather than a consumer, clinical, or animal-use product.
A COA matters when buying IGF-1 LR3 because it connects the material to batch-specific quality documentation. Researchers should review the compound name, lot number, purity data, identity method, test date, and product-form information. The COA supports procurement records, but it should be evaluated alongside the label and product page.
IGF-1 LR3 discussed here is a research-use-only material and is not intended for human or animal consumption. This article addresses laboratory procurement considerations such as COA review, identity documentation, purity data, supplier transparency, product form, and storage information. It does not provide use guidance.
Research use only means IGF-1 LR3 should be evaluated and handled only within controlled laboratory research procurement contexts by qualified researchers or technical procurement teams. RUO positioning focuses on documentation, labeling, identity testing, purity review, lot traceability, and storage records, not consumer outcomes or clinical applications.
Published literature about IGF-1 LR3 should be interpreted as scientific context for compound identity, IGF-system terminology, cell-culture research, or analytical methods. It should not be interpreted as guidance for any RUO material. Researchers should separate literature review from supplier documentation and batch-specific COA evaluation.
Qualified researchers evaluating IGF-1 LR3 should review product labeling, COA status, identity documentation, purity information, storage guidance, and supplier transparency before selecting any research-use-only material. Review the IGF-1 LR3 product page for RUO labeling, purity information, and available batch-specific documentation.
Our team is ready to assist you with any inquiries regarding our catalogue of peptides and their applications.
Discount Applied Successfully!
Your savings have been added to the cart.
There are no reviews yet.