ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are intended solely for research and laboratory use. These products are not intended for human or animal consumption. They are not medicines or drugs and have not been evaluated or approved by the FDA to diagnose, treat, cure, or prevent any disease or medical condition. Any form of bodily introduction is strictly prohibited by law.
IGF-1 LR3 1mg is an engineered variant of the insulin-like growth factor 1 (IGF-1) designed to increase potency and stability, making it ideal for research into growth factor-related processes. Produced using state-of-the-art synthesis methods, our IGF-1 LR3 offers exceptional purity and biological activity for demanding research needs.
IGF-1 LR3 1mg is widely appreciated in the research community for its role in advanced studies of growth factors, offering insights into cellular mechanisms and potential therapeutic targets.
| CAS No. | 946870-92-4 |
|---|---|
| Purity | ≥99% |
| Sequence | MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular Formula | C331H519N109O101 |
| Molecular Weight | 9117.60 g/mol |
| Synthesis | Solid-phase synthesis |
| Format | Lyophilized powder |
| Solubility | Soluble in water or 1% acetic acid |
| Stability & Storage | Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months. |
| Applications | Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders |
| Appearance | White lyophilized powder |
| Shipping Conditions | Shipped at ambient temperature; once received, store at -20°C |
| Regulatory/Compliance | Manufactured in a facility that adheres to cGMP guidelines |
| Safety Information | Refer to provided MSDS |
Consider these supplementary peptides for a comprehensive research approach.
Our team is ready to assist you with any inquiries regarding our catalogue of peptides and their applications.
There are no reviews yet.