1 / 6
Laboratory Research Material
IGF-1 LR3 1mg
Research Studies:
- Promotes potent IGF-1R tyrosine kinase phosphorylation to interrogate PI3K/Akt and MAPK/ERK intracellular signaling pathway cross-talk.
- Stimulates mitogenic responses in vitro to delineate specific mechanisms governing cellular proliferation and survival under experimental conditions.
- Facilitates the analysis of protein translation efficiency and metabolic flux within primary myogenic or osteogenic cell cultures.
- Utilized as a high-affinity ligand for competitive binding assays and characterizing endocrine-mediated signal transduction kinetics in vitro.
Out of stock
Important
Research Use Notice
All articles and product information provided on this website are for informational and educational purposes only. The products offered on this website are intended solely for research and laboratory use. These products are not intended for human or animal consumption. They are not medicines or drugs and have not been evaluated or approved by the FDA to diagnose, treat, cure, or prevent any disease or medical condition. Any form of bodily introduction is strictly prohibited by law.
Product Documentation
Details, specifications, and reviews
Description
IGF-1 LR3 1mg is a research-use-only laboratory material supplied for controlled research workflows, compound characterization, and analytical documentation review. It is manufactured under rigorous quality standards to support consistency, traceability, and batch-specific verification for qualified laboratory settings.
Key Product Details
- Manufactured in accordance with rigorous quality standards to support ≥99% purity, as reflected in batch-specific documentation where available.
- Every batch is third-party analyzed for identity, assay/potency, and sterility documentation where applicable.
- Supplied in lyophilized powder form to help preserve stability throughout transport and storage.
- Produced with lot-level traceability to support research documentation and laboratory recordkeeping.
Research Documentation Context
- Supports compound characterization in controlled laboratory settings.
- Provides batch-specific identity and purity documentation for research review.
- Allows lot-level traceability across laboratory documentation workflows.
- Supports comparison of product labeling, analytical documentation, and storage information during research planning.
- Supports analytical review of peptide research materials within a strictly laboratory-focused context.
Specifications and Documentation
- Certificate of Analysis: Available with batch-specific documentation where applicable.
- Material Safety Data Sheet: Coming Soon.
- Handling and Storage Instructions: Coming Soon.
- Product Form: Lyophilized powder.
- Purity Specification: ≥99% purity.
- Intended Use: Laboratory research use only.
IGF-1 LR3 1mg is intended strictly for laboratory research use only. This product is not intended for human or animal consumption, therapeutic use, diagnostic use, clinical use, veterinary use, or as a food, drug, cosmetic, dietary supplement, or household product.
Additional information
| CAS No. | 946870-92-4 |
|---|---|
| Purity | ≥99% |
| Sequence | MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular Formula | C331H519N109O101 |
| Molecular Weight | 9117.60 g/mol |
| Synthesis | Solid-phase synthesis |
| Format | Lyophilized powder |
| Solubility | Soluble in water or 1% acetic acid |
| Stability & Storage | Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months. |
| Applications | Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders |
| Appearance | White lyophilized powder |
| Shipping Conditions | Shipped at ambient temperature; once received, store at -20°C |
| Regulatory/Compliance | Manufactured in a facility that adheres to cGMP guidelines |
| Safety Information | Refer to provided MSDS |
Only logged in customers who have purchased this product may leave a review.
Need Assistance?
Questions about product documentation?
Our support team can assist with product records, lot information, order questions, and certificate verification.


There are no reviews yet.