...

IGF-1 LR3 1mg

$89.99

(5.0) (57 customer reviews)

Research Studies:

  • Promotes potent IGF-1R tyrosine kinase phosphorylation to interrogate PI3K/Akt and MAPK/ERK intracellular signaling pathway cross-talk.
  • Stimulates mitogenic responses in vitro to delineate specific mechanisms governing cellular proliferation and survival under experimental conditions.
  • Facilitates the analysis of protein translation efficiency and metabolic flux within primary myogenic or osteogenic cell cultures.
  • Utilized as a high-affinity ligand for competitive binding assays and characterizing endocrine-mediated signal transduction kinetics in vitro.

Quantity:

Free Shipping
Buy Peptides with confidence: Stripe-powered secure checkout and major cards accepted.
Secure payment methods for buying peptides: Visa, MasterCard, AMEX, and more.
Buy Peptides with confidence: Stripe-powered secure checkout and major cards accepted.
Secure payment methods for buying peptides: Visa, MasterCard, AMEX, and more.

FREE Shipping on 

orders over $200

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are intended solely for research and laboratory use. These products are not intended for human or animal consumption. They are not medicines or drugs and have not been evaluated or approved by the FDA to diagnose, treat, cure, or prevent any disease or medical condition. Any form of bodily introduction is strictly prohibited by law.

Description

IGF-1 LR3 1mg is a research-use-only laboratory material supplied for controlled research workflows, compound characterization, and analytical documentation review. It is manufactured under rigorous quality standards to support consistency, traceability, and batch-specific verification for qualified laboratory settings.

Key Product Details

  • Manufactured in accordance with rigorous quality standards to support ≥99% purity, as reflected in batch-specific documentation where available.
  • Every batch is third-party analyzed for identity, assay/potency, and sterility documentation where applicable.
  • Supplied in lyophilized powder form to help preserve stability throughout transport and storage.
  • Produced with lot-level traceability to support research documentation and laboratory recordkeeping.

Research Documentation Context

  • Supports compound characterization in controlled laboratory settings.
  • Provides batch-specific identity and purity documentation for research review.
  • Allows lot-level traceability across laboratory documentation workflows.
  • Supports comparison of product labeling, analytical documentation, and storage information during research planning.
  • Supports analytical review of peptide research materials within a strictly laboratory-focused context.

Specifications and Documentation

  • Certificate of Analysis: Available with batch-specific documentation where applicable.
  • Material Safety Data Sheet: Coming Soon.
  • Handling and Storage Instructions: Coming Soon.
  • Product Form: Lyophilized powder.
  • Purity Specification: ≥99% purity.
  • Intended Use: Laboratory research use only.

IGF-1 LR3 1mg is intended strictly for laboratory research use only. This product is not intended for human or animal consumption, therapeutic use, diagnostic use, clinical use, veterinary use, or as a food, drug, cosmetic, dietary supplement, or household product.

Additional information

CAS No.

946870-92-4

Purity

≥99%

Sequence

MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

C331H519N109O101

Molecular Weight

9117.60 g/mol

Synthesis

Solid-phase synthesis

Format

Lyophilized powder

Solubility

Soluble in water or 1% acetic acid

Stability & Storage

Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months.

Applications

Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders

Appearance

White lyophilized powder

Shipping Conditions

Shipped at ambient temperature; once received, store at -20°C

Regulatory/Compliance

Manufactured in a facility that adheres to cGMP guidelines

Safety Information

Refer to provided MSDS

There are no reviews yet.

We value your feedback. Please leave a review below:

Have Questions?

Our team is ready to assist you with any inquiries regarding our catalogue of peptides and their applications.

0